Protein Info for GFF5002 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: putative acetyltransferase [EC:2.3.1.-] [KO:K03830]

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 160 PF13673: Acetyltransf_10" amino acids 28 to 136 (109 residues), 76.9 bits, see alignment E=2.2e-25 PF00583: Acetyltransf_1" amino acids 28 to 129 (102 residues), 48.2 bits, see alignment E=1.9e-16 PF13508: Acetyltransf_7" amino acids 58 to 130 (73 residues), 52.1 bits, see alignment E=1.1e-17

Best Hits

KEGG orthology group: K03830, putative acetyltransferase [EC: 2.3.1.-] (inferred from 64% identity to bte:BTH_I2718)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (160 amino acids)

>GFF5002 putative acetyltransferase [EC:2.3.1.-] [KO:K03830] (Hydrogenophaga sp. GW460-11-11-14-LB1)
MRIRPFQPGDEPALYRVHREAIHRVASRDYTPEQIQAWAPARQDPGPWAIKMRHLRPFVA
EADGAIAGYADLQPSGYIDHFFVSADFPRQGVGRLLMERIHEEAARQGIAELTADVSKTA
QPFFARFGFEIVEQRFPVRAGVIIPNALMRKMLTPTQAAA