Protein Info for GFF5000 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Catechol 1,2-dioxygenase (EC 1.13.11.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04444: Dioxygenase_N
  • amino acids 22 to 95 (74 residues), 110.6 bits, E=2.7e-36
• PF00775: Dioxygenase_C
  • amino acids 102 to 273 (172 residues), 121.9 bits, E=2.2e-39

Best Hits

Swiss-Prot: 56% identical to CHQB_NOCSI: Hydroxyquinol 1,2-dioxygenase (chqB) from Nocardioides simplex

KEGG orthology group: K04098, hydroxyquinol 1,2-dioxygenase [EC: 1.13.11.37] (inferred from 78% identity to pol:Bpro_2064)

MetaCyc: 76% identical to 6-chlorohydroxyquinol-1,2-dioxygenase (Cupriavidus pinatubonensis JMP134)
1.13.11.-

Predicted SEED Role

"Catechol 1,2-dioxygenase (EC 1.13.11.1)" in subsystem Catechol branch of beta-ketoadipate pathway (EC 1.13.11.1)

MetaCyc Pathways

• superpathway of salicylate degradation (6/7 steps found)
• catechol degradation III (ortho-cleavage pathway) (5/6 steps found)
• aromatic compounds degradation via β-ketoadipate (7/9 steps found)
• catechol degradation to β-ketoadipate (3/4 steps found)
• 2,4,6-trichlorophenol degradation (5/7 steps found)
• resorcinol degradation (2/3 steps found)
• 4-nitrophenol degradation II (3/5 steps found)
• γ-resorcylate degradation I (2/4 steps found)
• γ-resorcylate degradation II (2/4 steps found)
• 4-aminophenol degradation (2/4 steps found)
• 2,4,5-trichlorophenoxyacetate degradation (5/9 steps found)
• mandelate degradation to acetyl-CoA (9/18 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (17/35 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Benzoate degradation via hydroxylation
• Carbazole degradation
• Fluorobenzoate degradation
• Toluene and xylene degradation
• gamma-Hexachlorocyclohexane degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.1 or 1.13.11.37

Protein Sequence (279 amino acids)

>GFF5000 Catechol 1,2-dioxygenase (EC 1.13.11.1) (Hydrogenophaga sp. GW460-11-11-14-LB1)
LRNLDQYNITQAVLARLANTPDPRLKQIMTSLVQHLHAFAREVNLTEAEWKAGIDFLTAT
GHMCDAQRQEFILLSDVLGLSMLTVAQNNDKPQGCTEATVFGPFHVEGAPHYEHGADVAN
GAAGTPCEVRGSVRGLNGEPVAGALIDVWQADAEGLYDVQRQDLTGAQGRGVLHSGPDGK
FHFQSVVAEPYPIPDDGPVGDLLRATARHPWRPAHLHFMIQAPGYETLVTHVFRDGDPYL
DSDAVFGVRQSLVTDWLQQPDGSYTLDFDFVLNRAKAAA