Protein Info for GFF500 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Uncharacterized protein YhjG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 686 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details amino acids 644 to 667 (24 residues), see Phobius details PF05170: AsmA" amino acids 1 to 582 (582 residues), 648.3 bits, see alignment E=7.3e-199

Best Hits

Swiss-Prot: 93% identical to YHJG_ECOLI: AsmA family protein YhjG (yhjG) from Escherichia coli (strain K12)

KEGG orthology group: K07290, hypothetical protein (inferred from 93% identity to eco:b3524)

Predicted SEED Role

"Uncharacterized protein YhjG"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (686 amino acids)

>GFF500 Uncharacterized protein YhjG (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MTKAGKITAAITGTFLLLIAIVILLIATFDWNRLKPTINQKVSTELNRPFAIRGDLGVVW
ERQKQETGWRSWVPWPHVHAEDVILGNPPDIPEVTMVHLPRVEATLAPLALLTKTVWLPW
IKLVKPDARLIRLSEKTNNWTFNLAQDKNTDPNAKPSAWSFRLDNILFDQGRIAIDDKVS
KADITILIDPLGKPLPFSEVTGTKGKADKSTVGDYVFGLKAQGRYNGEPLTGTGKIGGML
ALRSESTPFPVQADFRSGNTRVAFSGVVNEPMKMGGVDLRLKFSGDSLGDLYDLTGVLLP
DTPPFETDGRLVAKIDAEKSSVFDYRGFNGRIGDSDIHGSLTYTTGKPRPKLEGDVESRQ
LRLADLGPLIGVDSGKDAEQSKRSEQRKGEKNVQPADKVLPYDRFETDKWDVMDADVRFK
GRRIEHGGSLPISDLSTHIILKNADLRLQPLKFGLAGGSIVSNIHLEGDKKPMQGRADIQ
ARRLKLKELMPDVELMQKTLGELNGDADIRGTGNSVAALLGNSNGNLKLLMNDGLISRNL
MEIVGLNVGNYIVGQIFGDDEVRVNCAAANLNITNGVARPQIFAFDTENALINVTGTASF
ASEQLDLTIDPESKGIRIITLRSPLYVRGTFKNPQAGVKPGPLIARGAVAAALATLVTPA
AALLALISPSEGEANQCRTILTQMKQ