Protein Info for GFF50 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: glycosyl transferase, group 1 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 transmembrane" amino acids 46 to 59 (14 residues), see Phobius details amino acids 85 to 100 (16 residues), see Phobius details PF20706: GT4-conflict" amino acids 178 to 336 (159 residues), 45 bits, see alignment E=2e-15 PF00534: Glycos_transf_1" amino acids 207 to 358 (152 residues), 106.3 bits, see alignment E=3.2e-34 PF13692: Glyco_trans_1_4" amino acids 210 to 347 (138 residues), 100 bits, see alignment E=3.7e-32 PF13524: Glyco_trans_1_2" amino acids 237 to 365 (129 residues), 48.8 bits, see alignment E=1.9e-16

Best Hits

KEGG orthology group: None (inferred from 56% identity to msl:Msil_2612)

Predicted SEED Role

"glycosyl transferase, group 1 family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (386 amino acids)

>GFF50 glycosyl transferase, group 1 family protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MKVALSVPGKFHTFDLARELHAQGALAGILTGYPRFKLRHEQLPAALIRTFPWFMAPYMA
NPWQQRLPRHWTRAQEHLVATTFTAWAAAALPACDVYVGLSGSSLAAGRRQQRQGGRYVC
DRGSAHIRAQDDLLREEHREWGLPFEGVDPRNVEREEAEYAQADCITVPSAFAWQSFVRQ
GVPPHKVQRLPYGVDLARFARSGDPDARRFDLLFVGGMSLQKGVPYLLQAYRALKHPAKS
LKIAGTPSPELIAHLSAKGLWSPGIEVLGHVPQTELKHLMSRSHALVLPSVQDGFGMVLA
QAMACGCPVIASEHTGARDLFDDGQEGFIVPIRDAAALTDRFQRLADETGLRERMAAACI
ERVQRLGGWRDYGQRALGLYRQLVAT