Protein Info for GFF4996 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Oxygen-insensitive NADPH nitroreductase (EC 1.-.-.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00881: Nitroreductase
  • amino acids 16 to 172 (157 residues), 61.7 bits, E=5e-21

Best Hits

Swiss-Prot: 54% identical to Y1004_RALSO: Putative NADH dehydrogenase/NAD(P)H nitroreductase RSc1004 (RSc1004) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K09019, putative NADH dehydrogenase/NAD(P)H nitroreductase RutE [EC: 1.-.-.-] (inferred from 57% identity to bpt:Bpet1520)

MetaCyc: 51% identical to FAD reductase (NADH) (Cupriavidus nantongensis)
RXN-8506 [EC: 1.5.1.37]

Predicted SEED Role

"Oxygen-insensitive NADPH nitroreductase (EC 1.-.-.-)" (EC 1.-.-.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Carotenoid biosynthesis - General
• Insect hormone biosynthesis
• Nucleotide sugars metabolism
• Porphyrin and chlorophyll metabolism
• Puromycin biosynthesis
• Trinitrotoluene degradation
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.- or 1.5.1.37

Protein Sequence (193 amino acids)

>GFF4996 Oxygen-insensitive NADPH nitroreductase (EC 1.-.-.-) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MTLDAQALDQIFLKARTANTFLDKPVPDELLKQVYDIARMGPTSMNTQPARYVFLKTPEA
RARLLPALSPGNLDKTRAAPVTVIVCADNRFHEFMPQVWHREGAKENFESNPALSEATAT
RNSTLGGAYFIIAARALGLDCGPMSGVDLAKVNAEFFPDGRWRANFLINLGYGDGKVFDR
NARLSFEQACQVL