Protein Info for GFF4995 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: 3-oxoacyl-(acyl carrier protein) synthase (EC 2.3.1.41)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08545: ACP_syn_III
  • amino acids 111 to 186 (76 residues), 52.6 bits, E=3.5e-18
• PF08541: ACP_syn_III_C
  • amino acids 242 to 330 (89 residues), 61.4 bits, E=7.6e-21

Best Hits

KEGG orthology group: K00648, 3-oxoacyl-[acyl-carrier-protein] synthase III [EC: 2.3.1.180] (inferred from 59% identity to aex:Astex_2045)

Predicted SEED Role

"3-oxoacyl-(acyl carrier protein) synthase (EC 2.3.1.41)" (EC 2.3.1.41)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (48/53 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
• oleate biosynthesis IV (anaerobic) (13/14 steps found)
• superpathway of unsaturated fatty acids biosynthesis (E. coli) (17/20 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (14/16 steps found)
• biotin biosynthesis I (13/15 steps found)
• palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (8/9 steps found)
• fatty acid elongation -- saturated (5/5 steps found)
• gondoate biosynthesis (anaerobic) (4/4 steps found)
• 8-amino-7-oxononanoate biosynthesis I (9/11 steps found)
• fatty acid biosynthesis initiation (type II) (3/3 steps found)
• (5Z)-dodecenoate biosynthesis I (5/6 steps found)
• stearate biosynthesis II (bacteria and plants) (5/6 steps found)
• superpathway of fatty acid biosynthesis initiation (4/5 steps found)
• octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (9/12 steps found)
• palmitate biosynthesis III (21/29 steps found)
• (5Z)-dodecenoate biosynthesis II (4/6 steps found)
• stearate biosynthesis IV (4/6 steps found)
• fatty acid biosynthesis initiation (mitochondria) (2/4 steps found)
• tetradecanoate biosynthesis (mitochondria) (17/25 steps found)
• streptorubin B biosynthesis (20/34 steps found)
• mycolate biosynthesis (26/205 steps found)
• superpathway of mycolate biosynthesis (27/239 steps found)

KEGG Metabolic Maps

• Fatty acid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.180, 2.3.1.41

Use Curated BLAST to search for 2.3.1.180 or 2.3.1.41

Protein Sequence (330 amino acids)

>GFF4995 3-oxoacyl-(acyl carrier protein) synthase (EC 2.3.1.41) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MTKAYFNISGSGIALPRRVVSSSEIDRRIGMPDGHVAATFGIRQRRWADAEETSSALAAQ
AARQALQDAGWAADSVDVIVGACGVMEQPIPGTAPLVQRRLGLGGSGIAAYDVNATCLSF
LLALDHVLAGFALGRWRRALVFTADIASAALDFDNPEASVIFGDGAAAFALAADGPHQCL
GLRLETYADGAALCRLEAGGTRLRPADGLDQFLAAAKFRMDGLGVFRATARRFPKFMERL
LGAAGTRLDGISTVVPHQASQPALQHLKRYVPDGHAKTIDLFAEHGNQIATSLPHALHVA
RVTGRLRPGERALLIGSSAGISLGGAVLQW