Protein Info for GFF4994 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: FIG036672: Nucleoside-diphosphate-sugar epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 PF04321: RmlD_sub_bind" amino acids 5 to 171 (167 residues), 49.7 bits, see alignment E=1.2e-16 PF01370: Epimerase" amino acids 6 to 230 (225 residues), 121 bits, see alignment E=2.2e-38 PF05368: NmrA" amino acids 6 to 250 (245 residues), 28.9 bits, see alignment E=3.1e-10 PF01073: 3Beta_HSD" amino acids 7 to 253 (247 residues), 70.5 bits, see alignment E=5e-23 PF16363: GDP_Man_Dehyd" amino acids 7 to 253 (247 residues), 49.6 bits, see alignment E=1.7e-16 PF13460: NAD_binding_10" amino acids 10 to 170 (161 residues), 56.1 bits, see alignment E=1.9e-18 PF07993: NAD_binding_4" amino acids 56 to 172 (117 residues), 56.6 bits, see alignment E=9.1e-19

Best Hits

KEGG orthology group: None (inferred from 52% identity to aex:Astex_2044)

Predicted SEED Role

"FIG036672: Nucleoside-diphosphate-sugar epimerase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (330 amino acids)

>GFF4994 FIG036672: Nucleoside-diphosphate-sugar epimerase (Hydrogenophaga sp. GW460-11-11-14-LB1)
VVNGRVLVTGATGGLGRVLVPALAAQGCEVVATGRQDHIGRALVGPGISFRAADLTRDAL
DPLLDGVDTVFHLAALSSPWGRRAAFEMANVTATHRLLEAAQAHGCRRFIHTSTPSIYVD
RRHQLLLTEDSPLPSRWVNDYARTKFEGERLVRKAASTGMATVVLRPRAIVSPFDSVLLP
RLLRAADRGAVWLPAGGRALVELTDARDVVAALLAACSLAEAVNGQVFNVSGGKPMPIAQ
IASLVFDALGRPLRVHSINPHLSLAMGALAETLARLWPSRPEPPLTRYGAMVAAWSQTFD
LTAARTRLQWTPRHSPEDAIIWALQEGAHA