Protein Info for PS417_25580 in Pseudomonas simiae WCS417

Annotation: 50S ribosomal protein L10

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 166 PF00466: Ribosomal_L10" amino acids 5 to 101 (97 residues), 98 bits, see alignment E=3e-32 PF27436: RL10_C" amino acids 131 to 164 (34 residues), 52.9 bits, see alignment 2.6e-18

Best Hits

Swiss-Prot: 96% identical to RL10_PSEFS: 50S ribosomal protein L10 (rplJ) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K02864, large subunit ribosomal protein L10 (inferred from 95% identity to psb:Psyr_4557)

MetaCyc: 70% identical to 50S ribosomal subunit protein L10 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L10p (P0)" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U251 at UniProt or InterPro

Protein Sequence (166 amino acids)

>PS417_25580 50S ribosomal protein L10 (Pseudomonas simiae WCS417)
MAINLEDKKAIVAEVNEAAKAALSAVVADARGVTVGAMTGLRKEAREAGVYVRVVRNTLL
KRAVADTEYSVLNDVFTGPTLIAFSKEHPGAAARLFKEFAKSQEKFEIKAAAFEGKFLAA
NQIDVLATLPTRDEAISQLMSVIQGATSKLARTLAAVREQKEAAAA