Protein Info for GFF4986 in Variovorax sp. SCN45

Annotation: 3-hydroxybenzoate 6-monooxygenase (EC 1.14.13.24)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF01494: FAD_binding_3" amino acids 9 to 322 (314 residues), 84 bits, see alignment E=2.5e-27 PF01134: GIDA" amino acids 10 to 162 (153 residues), 23.3 bits, see alignment E=6.2e-09 PF13450: NAD_binding_8" amino acids 13 to 43 (31 residues), 22.9 bits, see alignment (E = 1.7e-08)

Best Hits

Swiss-Prot: 64% identical to 3HBH_KLEOX: 3-hydroxybenzoate 6-hydroxylase (mhbM) from Klebsiella oxytoca

KEGG orthology group: K00480, salicylate hydroxylase [EC: 1.14.13.1] (inferred from 95% identity to vpe:Varpa_0370)

Predicted SEED Role

"Putative n-hydroxybenzoate hydroxylase" in subsystem Gentisare degradation or Salicylate and gentisate catabolism

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.1

Use Curated BLAST to search for 1.14.13.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (407 amino acids)

>GFF4986 3-hydroxybenzoate 6-monooxygenase (EC 1.14.13.24) (Variovorax sp. SCN45)
MTLSKNPPSVLLVGGGIGGMAAALALARLGVSIDLLEQSATIGEIGAGLQLGPNAFAALD
ALGVGEAVRRGSVFTDRLVMMDAVDCGEVASVPVGEAFRARFRNPYAVSHRADLHGAIHE
AVKQHPLIRFHTSAQVESIDTGAQSVTAVTTDGRRFKADAIVGCDGVKSVVRARLIGDAP
RVSGHVVYRAVVPAADMPADLCWNAPVVWAGPNCHLVHYPLRHGEQYNLVVTFHSREREE
WGVTDGSKEEVLSYFEGVHARPRQLLDRPTSWRRWSTADRDPVERWSDGPATLLGDAAHP
MMQYLAQGACMALEDAVTLGEAVKACDFDMVAAFKLYEAARVARTARVVLSVREMGRIYH
AKGVERLVRNSLWTGRTPERFYDAVEWLYAWRPEHCLDDAPPALSPR