Protein Info for GFF4983 in Variovorax sp. SCN45

Annotation: fumarate reductase/succinate dehydrogenase flavoprotein-like

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 PF07992: Pyr_redox_2" amino acids 19 to 62 (44 residues), 27.6 bits, see alignment 7e-10 PF12831: FAD_oxidored" amino acids 20 to 440 (421 residues), 387.7 bits, see alignment E=3.1e-119 PF01134: GIDA" amino acids 20 to 173 (154 residues), 34.1 bits, see alignment E=5.8e-12 PF00890: FAD_binding_2" amino acids 20 to 67 (48 residues), 29.8 bits, see alignment 1.3e-10

Best Hits

KEGG orthology group: None (inferred from 86% identity to vpe:Varpa_0373)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (449 amino acids)

>GFF4983 fumarate reductase/succinate dehydrogenase flavoprotein-like (Variovorax sp. SCN45)
MPVQTLHEPARELPVFGTYDVVVVGGGPAGIAAAVSAARHGANTLLVERYGFLGGMGTAG
GVTNFAGLYGKRKGEMTQLVHGVVDELIDRIAGLNGMNQPQNGMGGRICVRSYDTSAYKL
AADQLLEAAGVKLLFHAYAAAVVRDGSRIAALVVETKSGRQAIRANAFIDASGDADVAAF
AGVPFEVGDGHGSGLFPTTMFRIGQVDAPAALEAVGEFKAINDFMARAEQQKPGVYKFPR
EGAILRPNKDPREWRANVTQIRNAQGRAMNGVDARELTEGELEGRRQISEYFKFLKAEVP
GFAQSAIVEIAPQVGIRETRRIRGLYALEREDILSSAKFDDNIGLNAWPMEMHADGRIEW
AFPRDEDNAYNHLPWRMLVPQTVDNLLVAGRCASMTHEGQSAARASGGCFVMGQAAGTAA
ASLGGDAFAGVDVPALQRKLAADGADLDR