Protein Info for PS417_25485 in Pseudomonas simiae WCS417

Annotation: 50S ribosomal protein L14

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 122 TIGR01067: ribosomal protein uL14" amino acids 1 to 122 (122 residues), 192.3 bits, see alignment E=1.1e-61 PF00238: Ribosomal_L14" amino acids 1 to 122 (122 residues), 186.5 bits, see alignment E=7.3e-60

Best Hits

Swiss-Prot: 100% identical to RL14_PSEU2: 50S ribosomal protein L14 (rplN) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K02874, large subunit ribosomal protein L14 (inferred from 98% identity to pap:PSPA7_0847)

MetaCyc: 85% identical to 50S ribosomal subunit protein L14 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L14p (L23e)" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UIC9 at UniProt or InterPro

Protein Sequence (122 amino acids)

>PS417_25485 50S ribosomal protein L14 (Pseudomonas simiae WCS417)
MIQTQSMLDVADNSGARRVMCIKVLGGSHRRYAGIGDIIKVTVKEAIPRGKVKKGQVMTA
VVVRTRHGVRRADGSIIRFDGNAAVLLNNKQEPIGTRIFGPVTRELRTEKFMKIVSLAPE
VL