Protein Info for GFF4969 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: PAS/PAC sensor signal transduction histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 674 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 276 to 298 (23 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 310 to 436 (127 residues), 67 bits, see alignment E=8.9e-23 PF13188: PAS_8" amino acids 316 to 366 (51 residues), 28.5 bits, see alignment 3.6e-10 PF00989: PAS" amino acids 317 to 427 (111 residues), 46.7 bits, see alignment E=1e-15 PF24820: Diguanyl_cycl_sensor" amino acids 320 to 425 (106 residues), 29.2 bits, see alignment E=2.8e-10 PF08448: PAS_4" amino acids 321 to 432 (112 residues), 32 bits, see alignment E=4.4e-11 PF13426: PAS_9" amino acids 325 to 429 (105 residues), 37.3 bits, see alignment E=9.9e-13 PF07730: HisKA_3" amino acids 460 to 525 (66 residues), 40.3 bits, see alignment E=1.4e-13 PF02518: HATPase_c" amino acids 574 to 658 (85 residues), 31.9 bits, see alignment E=5.7e-11

Best Hits

Predicted SEED Role

"PAS/PAC sensor signal transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (674 amino acids)

>GFF4969 PAS/PAC sensor signal transduction histidine kinase (Hydrogenophaga sp. GW460-11-11-14-LB1)
VVALMLLILSLFLAEIIVANELARRAGSRVEQAAQLYADQISRSLARRTVELQLLGEMAR
ADIRPPTWRDQMQRLKISTNAYVWIGVTDAQGQVEVASDGLLEGTSIASRGVFINGKDGL
WFGSLHPPVALREPLAARGMRVPEQLADIAMPVYDAQGLSRGVIAAHLDAAFFNQLRDQV
LGPSEARRVMDLALVDDSGHVLIGDRPTVSDSEWNFLLASPEEKTHTVPDDKGEPYILAR
SAIQPRDSELRTSWQVVGYQPLSAALAPVRQLERSLLTWGGIATLLLGLAGFAVSRYLAR
PYSQSEQHLREQGEVLAAVINSASDAVISVDVRGRISLFNPAAARIFGHPASSMIGQPLD
TLLPLTQRSGHLGHLQRFAESQSTTRPMGVGRVTGLRADGQELDLEASISQITVRGHKVL
TAILRDVTERVRAERAVAQYQLELSELTHRLLHQEKQTTRRLAQILHDQLGQTLGAIRLS
FDALTGMIPLNLPDKARDRATKLGDMIDAANTEVRQVLVELRPPLLDELGLQAALENEVH
TRIPDAEPVALRLKIAPHAGDTRWPADVEYVAFMVAREALANAVLHANASEVVVKIDGEA
EWLHLQVLDDGKGLSPKLAAGRPGHLGIVGMRERALAIGARMEARGRPQGGTEISLTWGT
QPAGPPGEPSSARP