Protein Info for GFF4964 in Pseudomonas sp. DMC3

Annotation: Pyruvate dehydrogenase complex repressor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 PF00392: GntR" amino acids 12 to 74 (63 residues), 77.3 bits, see alignment E=5.8e-26 PF07729: FCD" amino acids 99 to 229 (131 residues), 79.1 bits, see alignment E=4e-26

Best Hits

KEGG orthology group: K05799, GntR family transcriptional regulator, transcriptional repressor for pyruvate dehydrogenase complex (inferred from 98% identity to pfo:Pfl01_0754)

Predicted SEED Role

"Lactate-responsive regulator LldR in Enterobacteria, GntR family" in subsystem Lactate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (255 amino acids)

>GFF4964 Pyruvate dehydrogenase complex repressor (Pseudomonas sp. DMC3)
MGFDQIRQRRLSDDIVERLEGMILEGTLKSGERLPAERTLAEQFGVSRPSLREAIQKLAA
KGLLVSRQGGGNYVVEGLGSTFSDPLLQLLESNPEAQRDLLEFRHTLEASCAYYAALRAT
DVDRERLTAAFEELQDCYSRHEEVSRAEEGAADAKFHLAIAEASHNAVLLHTIRGLFDLL
KRNVVTNIGGMYKQRTETRDMLISQHRELYLAIIEGRAEQAREVSSRHILYVQEVLEEVR
QEVQRMARAERRKGM