Protein Info for GFF4962 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Excinuclease ABC subunit B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 706 TIGR00631: excinuclease ABC subunit B" amino acids 35 to 693 (659 residues), 1055.5 bits, see alignment E=0 PF04851: ResIII" amino acids 46 to 117 (72 residues), 41.1 bits, see alignment E=5.5e-14 PF00270: DEAD" amino acids 47 to 116 (70 residues), 24.7 bits, see alignment E=5.4e-09 PF17757: UvrB_inter" amino acids 190 to 279 (90 residues), 114.6 bits, see alignment E=5.5e-37 PF00271: Helicase_C" amino acids 464 to 574 (111 residues), 77.1 bits, see alignment E=3.8e-25 PF12344: UvrB" amino acids 581 to 623 (43 residues), 70.1 bits, see alignment 3.3e-23 PF02151: UVR" amino acids 661 to 695 (35 residues), 35.8 bits, see alignment (E = 1.5e-12)

Best Hits

Swiss-Prot: 79% identical to UVRB_CUPNJ: UvrABC system protein B (uvrB) from Cupriavidus necator (strain JMP 134 / LMG 1197)

KEGG orthology group: K03702, excinuclease ABC subunit B (inferred from 84% identity to rfr:Rfer_2175)

MetaCyc: 68% identical to UvrABC excision nuclease subunit B (Escherichia coli K-12 substr. MG1655)
3.1.25.-

Predicted SEED Role

"Excinuclease ABC subunit B" in subsystem DNA repair, UvrABC system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (706 amino acids)

>GFF4962 Excinuclease ABC subunit B (Hydrogenophaga sp. GW460-11-11-14-LB1)
MPQTTLPPTPKDPLIEGVSDAPPEGEFLTFPGSPFELFLPYPPAGDQPEAIRQLVEGVND
GEVFQTLLGVTGSGKTFTMANVIARLGRPAIVFAPNKTLAAQLYSEFREFFPKNAVEYFV
SYYDYYQPEAYVPQRDLFIEKDSAINEHIEQMRLSCTKSILERRDVVIVATVSAIYGIGK
PESYHQMVMTLRTGDKIGQRDLIAQLVRMQYARNEQDFSRGKFRVRGDTIDVFPAEHSEM
AIRIELFDDEVETLQLFDPLTGKVRQKIPRFTVYPSSHYVTPREQVLHAVEAIKLELADR
LKQLVGEGKLVEAQRLEQRTRFDVEMLSEVGHCKGIENYSRHLAGSAPGEPPSTLTDYLP
KDAVMFLDESHVLMGQFGGMYNGDRARKTTLVEYGFRLPSALDNRPLKLEEFEQRMRQVV
FVSATPADYEKTHAGQVVEQLVRPTGLVDPELEVRPATHQVDDVLQEIRIRVEKNERVLI
TTLTKRMAEQLTDYLTENGVKVRYLHSDVDTVERVEIIRDLRLGAFDVLVGINLLREGLD
IPEVSLVAILDADKEGFLRSERSLIQTIGRAARNLGGKAILYADRITDSMKRAMDETQRR
RDKQIAHNLAMGIEPRSINKRIKDLIDGVYSEKAGREADRLAAESAQRASVEDMSEKDVA
REIKRLEKLMLEHARNLEFEKAAGVRDQLAHLKAQVFGAPGTDSIA