Protein Info for GFF496 in Methylophilus sp. DMC18

Annotation: UvrABC system protein C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 599 TIGR00194: excinuclease ABC subunit C" amino acids 8 to 579 (572 residues), 641.7 bits, see alignment E=6.3e-197 PF01541: GIY-YIG" amino acids 16 to 89 (74 residues), 40.5 bits, see alignment E=8.6e-14 PF02151: UVR" amino acids 202 to 234 (33 residues), 31.7 bits, see alignment (E = 2.8e-11) PF22920: UvrC_RNaseH" amino acids 248 to 361 (114 residues), 110.7 bits, see alignment E=1.2e-35 PF08459: UvrC_RNaseH_dom" amino acids 377 to 532 (156 residues), 192.5 bits, see alignment E=1.3e-60 PF14520: HHH_5" amino acids 547 to 598 (52 residues), 37.9 bits, see alignment 6.2e-13 PF12826: HHH_2" amino acids 551 to 596 (46 residues), 27.8 bits, see alignment 7e-10

Best Hits

Swiss-Prot: 77% identical to UVRC_METFK: UvrABC system protein C (uvrC) from Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875)

KEGG orthology group: K03703, excinuclease ABC subunit C (inferred from 81% identity to mmb:Mmol_0775)

Predicted SEED Role

"Excinuclease ABC subunit C" in subsystem DNA repair, UvrABC system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (599 amino acids)

>GFF496 UvrABC system protein C (Methylophilus sp. DMC18)
MFDPKPILKNLPNLPGVYRMLNAENTVIYVGKAKDLKKRVSSYFNKNLASPRTKMMVSQI
TNIETTVTRSEAEALLLENNLIKSIMPRYNVLFRDDKSYPYISLTGDAFPRLAFHRGTQR
KGHQYFGPFPSSPAVRESIQLLQKVFKLRTCENTVFANRSRPCLQYQIARCTAPCVNLIS
QEDYASDVRHAALFLLGKTSEVMDSLADGMNAAAEAMEYEQAAVLRDRIQALRQVQAKQF
VSDFSVSDADVIACAEIEGQHCINLVMIRGGRHLGDKSFFPKNAQDAELVETVEAFITQY
YVAQNTPPLLVCGAEIDKTEFETMLSEQAERKIRVLTNAIGDKKVWLKMAQTNAELALQQ
RQATSANQQARLLSLREALNLAENTERIECFDISHTMGEATVGSCVVFDRGDMQNSEYRR
YNVTGITPGDDYAAMRDVLTRRYKKVAAGEGKRPDLIFIDGGKGQLGVAMEVMQEVGLDD
ILLIGIAKGEERKPGLETMIFSDTGEMLNLPVDNPGLHLLQQIRDEAHRFAITGHRAKRA
KARITSSLEEIEGVGAKRRKALLTRFGGLDAIKSASIDEIAQVEGISLALAQTIYERLH