Protein Info for GFF4959 in Variovorax sp. SCN45

Annotation: ABC transporter, permease protein 2 (cluster 4, leucine/isoleucine/valine/benzoate)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 40 to 68 (29 residues), see Phobius details amino acids 87 to 108 (22 residues), see Phobius details amino acids 114 to 135 (22 residues), see Phobius details amino acids 162 to 179 (18 residues), see Phobius details amino acids 207 to 230 (24 residues), see Phobius details amino acids 249 to 274 (26 residues), see Phobius details amino acids 286 to 308 (23 residues), see Phobius details PF02653: BPD_transp_2" amino acids 35 to 296 (262 residues), 141 bits, see alignment E=2.1e-45

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 94% identity to vap:Vapar_0364)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (329 amino acids)

>GFF4959 ABC transporter, permease protein 2 (cluster 4, leucine/isoleucine/valine/benzoate) (Variovorax sp. SCN45)
MKTSPSRYIGLGLLLVLLAAFPLIAPLFGLEFYIGFVRRVLIVALAAASLNFILGFGGMV
ALGHAGFIGMGAYTVVALSDAGVMSGWIMWPAAALVAGLVAALIGTVALRTRGVYFIMTT
LAFAQMLYFVVVSLRRYGGDDGYTLMSRPTLLPGLDLGNESNFYWVVLAIVALALWWLHR
ATRSRFGHALMGIRDNETRMRALGYPVFRLQLVAFAIAGAIAGLAGALLAGGNGFVSPAT
MHWTQSATLLVMVVIGGLGRSWGGPVGAVVWLVLEEVLKQHTEHWHMPLGLLLIAVALWA
PKGLAALYRRRLPLTPTLSPEGQGSKTTP