Protein Info for GFF4955 in Variovorax sp. SCN45

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 668 transmembrane" amino acids 173 to 194 (22 residues), see Phobius details amino acids 201 to 219 (19 residues), see Phobius details amino acids 233 to 255 (23 residues), see Phobius details amino acids 264 to 286 (23 residues), see Phobius details amino acids 292 to 314 (23 residues), see Phobius details amino acids 321 to 342 (22 residues), see Phobius details amino acids 355 to 374 (20 residues), see Phobius details PF07696: 7TMR-DISMED2" amino acids 29 to 151 (123 residues), 50.1 bits, see alignment E=4.3e-17 PF00512: HisKA" amino acids 447 to 500 (54 residues), 32.1 bits, see alignment 1.4e-11 PF02518: HATPase_c" amino acids 553 to 662 (110 residues), 84.9 bits, see alignment E=8e-28

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (668 amino acids)

>GFF4955 hypothetical protein (Variovorax sp. SCN45)
MWAAPAFPAHAARVDDGDGLAQPFSLASSLEVLRGPRDALPEQEVLSGRRDADFTPADPD
AGPLACAQGTVCWVRFSLARTDLAPDDWLLRVRTVRPGSVELYEPKEAGAYEQSLTGRQF
PLNWRFATTDLFFPLNLPTSPTTYYLRLDDTPSADGFSLFQSGGFERQQRQYGAYLNISM
GVAFALLVINLVFWRWLRDTLFLHFAFVMCAAVLLHAWQTVPSTWEPQRLGDLGLRAALQ
GLMQAAIVLFVARLFELRRHMPGAWCTAQAFAVLNLLIGATAWAGHHEPLEFWVAVIDLA
GLGGSVLVAGWLLFVRRQWQFAWPAVLTLFLAFSSGLGRLQWLGWVDVGPDEGLGVTWAA
VRLAYMLLLAIVVADRTRQAEMLLRAARGRALEDALRAERQLEDKVHERTQALGRSNAQL
AAEIEGRRLAEASLQRALASEREAMQQQRQFVSLVSHEFRTPLAVIDATAQSIALPGVEI
QPRLAKIRRAVQRLTLLVVNCLADDRFHAEGAALKVERVDLRALVERLVQAFGPTDRARI
RFSLPACEAWTDGDAALLEIALHNLVQNAVHYSPAECDVRVSLALVEGGMARVDVEDFGS
GIPPDEQARIFERFFRGTSSRKASGTGLGLFLCSEIARAHGGSAVLLRSGPQGSVFRVEV
PMSGARST