Protein Info for GFF4953 in Sphingobium sp. HT1-2

Annotation: FIG006611: nucleotidyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 235 PF00483: NTP_transferase" amino acids 5 to 113 (109 residues), 55.4 bits, see alignment E=7.1e-19 PF12804: NTP_transf_3" amino acids 6 to 68 (63 residues), 33.5 bits, see alignment E=4.9e-12

Best Hits

Swiss-Prot: 46% identical to MURU_CAUVC: N-acetylmuramate alpha-1-phosphate uridylyltransferase (murU) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: None (inferred from 86% identity to sch:Sphch_0729)

Predicted SEED Role

"FIG006611: nucleotidyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (235 amino acids)

>GFF4953 FIG006611: nucleotidyltransferase (Sphingobium sp. HT1-2)
MIDTAMLMAAGLGKRMRPLTATRPKPLVKVAGKALMDHALDRLAAGGIKTVVVNVHYLAD
TVEAHLKTRKDMDFRISDERAKLLETGGGLIHARPLLGDKPFICANSDNLWIDGPAETLG
MMQRLWDPERMDALLLLVPLARANCHSGPGDFHMDANGRLTRRKIAHVAPFVFTGVQILS
PRLLVDPPADVFSTNIFWNRAIEAGRLYGAVHQGLWFDVGTPQAIPVVESMIAHG