Protein Info for GFF495 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Type III secretion outermembrane pore forming protein (YscC,MxiD,HrcC, InvG)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 580 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details PF03958: Secretin_N" amino acids 170 to 312 (143 residues), 34.6 bits, see alignment E=1.8e-12 TIGR02516: type III secretion outer membrane pore, YscC/HrcC family" amino acids 271 to 545 (275 residues), 285.9 bits, see alignment E=2.4e-89 PF00263: Secretin" amino acids 387 to 544 (158 residues), 118 bits, see alignment E=3.4e-38

Best Hits

Predicted SEED Role

"Type III secretion outermembrane pore forming protein (YscC,MxiD,HrcC, InvG)" in subsystem Type III secretion systems, extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (580 amino acids)

>GFF495 Type III secretion outermembrane pore forming protein (YscC,MxiD,HrcC, InvG) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MVFCAAVGLAPLAHTAPLPFDGSAYSYYASDTPIAKMLAEFCANFGLRLQIDPGIVTRVS
GRLAAPSASEFLNTVTASAGLDWFHYAGAIHVTRVSERDTQVHAIARETIPGLRNALLDL
KILDERFGWAALADQGMVVVSGPPAYLDLIAKTMRTVQAAPNGQQMVVWKLKYANVEDRQ
VTIRDKTTVVPGVRTLLQALGGGRAHLAVAGSASQEGGVRLEPLKSAPSVHGGSVDPSSG
AGPGSDAGSAAGRGGVAPPASADRAAPGRPQAFTGREVSIEADVRLNAIVMKGPADLIAG
YQALISALDTPAGLVEIEAITIDVNKSRLEELGIDWSANARRVNVGFGDASLPTASGILS
LGYRSAAAATTVVADQANALLARIRLLETTGDAYVAGKPSILTSDNLSALIDLSQTFYAK
VTGERVANLTPVTVGVMLKVSPRIVTTDAGQTEIQLVIDIEDGSLVDRTGLDLPVVQRTT
ISTQATIREGQSLLIGGYDTETQQNSMEKVPLLGDIPKLGALFRTTRVDQQRRKRMFLIT
PRIVSIGAPVASLARPVQIPSDATVLHPMLRIEKSLGALP