Protein Info for GFF495 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Aerobic C4-dicarboxylate transporter for fumarate, L-malate, D-malate, succunate

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 transmembrane" amino acids 9 to 28 (20 residues), see Phobius details amino acids 42 to 64 (23 residues), see Phobius details amino acids 76 to 99 (24 residues), see Phobius details amino acids 141 to 164 (24 residues), see Phobius details amino acids 184 to 208 (25 residues), see Phobius details amino acids 219 to 243 (25 residues), see Phobius details amino acids 297 to 317 (21 residues), see Phobius details amino acids 326 to 344 (19 residues), see Phobius details amino acids 350 to 374 (25 residues), see Phobius details PF00375: SDF" amino acids 9 to 401 (393 residues), 396.1 bits, see alignment E=8.9e-123

Best Hits

Swiss-Prot: 100% identical to DCTA_SALEP: C4-dicarboxylate transport protein (dctA) from Salmonella enteritidis PT4 (strain P125109)

KEGG orthology group: K11103, aerobic C4-dicarboxylate transport protein (inferred from 100% identity to ses:SARI_04020)

MetaCyc: 95% identical to C4 dicarboxylate/orotate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-121; TRANS-RXN-121A; TRANS-RXN-121C; TRANS-RXN-122A; TRANS-RXN0-451; TRANS-RXN0-517; TRANS-RXN0-553

Predicted SEED Role

"Aerobic C4-dicarboxylate transporter for fumarate, L-malate, D-malate, succunate" in subsystem Pyruvate metabolism I: anaplerotic reactions, PEP

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (428 amino acids)

>GFF495 Aerobic C4-dicarboxylate transporter for fumarate, L-malate, D-malate, succunate (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKTSLFKSLYFQVLTAIAIGILLGHYYPELGAQMKPLGDAFVKLIKMIIAPVIFCTVVTG
IAGMESMKAVGRTGAVALLYFEIVSTIALIIGLIIVNVVQPGAGMNVDPATLDAQAVAVY
AAQAKEQGIIAFLMDVIPGSVIGAFASGNILQVLLFAVLFGFALHRLGSKGQLIFNVIES
FSQVIFGIINMIMRLAPIGAFGAMAFTIGKYGVGSLVQLGQLIICFYITCILFVVVVLGT
IARVTGFSIFKFIRYIREELLIVLGTSSSESALPRMLDKMEKLGCRKSVVGLVIPTGYSF
NLDGTSIYLTMAAVFIAQATNSHMDIFHQITLLVVLLLSSKGAAGVTGSGFIVLAATISA
VGHLPVAGLALILGIDRFMSEARALTNLVGNGVATVVVAKWVKELDHQKLDDVLNNRAPD
GKTHEISS