Protein Info for GFF4949 in Variovorax sp. SCN45

Annotation: ABC transporter, ATP-binding protein (cluster 2, ribose/xylose/arabinose/galactose) / ABC transporter, ATP-binding protein (cluster 2, ribose/xylose/arabinose/galactose)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 507 PF00005: ABC_tran" amino acids 23 to 173 (151 residues), 102.1 bits, see alignment E=4.1e-33 amino acids 275 to 429 (155 residues), 81.6 bits, see alignment E=8.6e-27

Best Hits

Swiss-Prot: 60% identical to RBSA2_RHIME: Ribose import ATP-binding protein RbsA 2 (rbsA2) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K10441, ribose transport system ATP-binding protein [EC: 3.6.3.17] (inferred from 86% identity to vap:Vapar_0372)

MetaCyc: 44% identical to ribose ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-28-RXN

Predicted SEED Role

"Ribose ABC transport system, ATP-binding protein RbsA (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.17

Use Curated BLAST to search for 3.6.3.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (507 amino acids)

>GFF4949 ABC transporter, ATP-binding protein (cluster 2, ribose/xylose/arabinose/galactose) / ABC transporter, ATP-binding protein (cluster 2, ribose/xylose/arabinose/galactose) (Variovorax sp. SCN45)
VNAVSALLELKGISKRFGASRALTGVDFTLHAGEIHALCGENGAGKSTLMNIIDGIHQPD
EGETSLDGRKVVIDGPAHAMRLGIGLVHQEIALCGDATVAENIFMPEINAGKHAWMNYAS
LNERAARVLQRLGQDVDPAALVKDLSISTQQLIEIAKALTLDCKVLILDEPTAALTDNES
AALFKVLHDLKAQGIGIIYISHRMAEIFAHCSRVTVLRDGRNVHCGPLAELDADALVRRM
VGRDLGNYYPPKHGDAAHGEPVLEVSDIADGERVHGVSFTLRRGEILGIAGLMGAGRSEL
AETVCGLRTATRGAVRLRGRTLAIRKYSDALREGIAYLSEDRKAAGVYLDLPIAQNIASM
ALRRVSSRFGLLQRAAERKLALDLGGKLKLKSDGVDIDVASLSGGNQQKVAIAKLLATNP
SVLLMDEPTRGVDVGAKSEIHHILRELASQGVGVVVISSELPEIIGLCDRALVIRDGRLA
GEVQDNEMTEEALLRLASGLCEEEATA