Protein Info for GFF4943 in Variovorax sp. SCN45

Annotation: Chloride channel protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 59 to 79 (21 residues), see Phobius details amino acids 110 to 131 (22 residues), see Phobius details amino acids 163 to 188 (26 residues), see Phobius details amino acids 200 to 220 (21 residues), see Phobius details amino acids 238 to 259 (22 residues), see Phobius details amino acids 280 to 302 (23 residues), see Phobius details amino acids 326 to 351 (26 residues), see Phobius details amino acids 367 to 391 (25 residues), see Phobius details amino acids 397 to 416 (20 residues), see Phobius details PF00654: Voltage_CLC" amino acids 74 to 416 (343 residues), 277.8 bits, see alignment E=6.8e-87

Best Hits

KEGG orthology group: None (inferred from 93% identity to vpe:Varpa_5780)

Predicted SEED Role

"Chloride channel protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (459 amino acids)

>GFF4943 Chloride channel protein (Variovorax sp. SCN45)
MNREPDFLEHLRAELSSGRVWLDRAIVLGYAIAAGLFVVGFTLASDWVFGQFHRFYRAWP
WAVLLTTPLLTAGIVWFTLRFFPGAGGSGIPQIKAALHPALPEERRFFFASLRLTVAKIG
LGAAGFAAGLSIGREGPSVQVAAGVMQHARRWLSPNTTIDGRALLVAGGAAGIAAAFNAP
LAGVVFAIEELSGRLEARSSGLIITAIVLAGLVAVSAFGNTSYFGVIRVPRLGWDALGPG
LLVTLLSGAAGGLFARLLTASLTGAPGRFNRWRARFPVRFAAAGGLAVAVIGLVTGGVTF
GAGSEAVKQMLQGHDELTPLYTVLKFVATWLTAWCGVPGGIFAPALSIGAGIGDAVSQLG
SSELGPALIALGMAAFLAAVTQAPLTAFIIVMEMVDGHSMVLSLMAAAMLASLVSRMISR
PLYDTLAEYMVGRAIGAAEPVHPPPEAPAPRPPEPARSP