Protein Info for GFF4943 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Bona fide RidA/YjgF/TdcF/RutC subgroup

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 133 PF01042: Ribonuc_L-PSP" amino acids 22 to 129 (108 residues), 90.8 bits, see alignment E=3.4e-30

Best Hits

Swiss-Prot: 38% identical to RIDA_PYRFU: 2-iminobutanoate/2-iminopropanoate deaminase (yjgF) from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)

KEGG orthology group: None (inferred from 51% identity to mci:Mesci_0892)

Predicted SEED Role

"Bona fide RidA/YjgF/TdcF/RutC subgroup"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (133 amino acids)

>GFF4943 Bona fide RidA/YjgF/TdcF/RutC subgroup (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSPNPGIEHIGPPVERAGQVQPISPAVVVEDRLVFVAGQVPMRNGQPAGEDIASQTHYTL
DLIEAILQRAGCTLADVVKTTVWLVNAKDYPGFNAAYAERFPAATAPARSTVISGLIAPV
LVEIEAVALRRPG