Protein Info for GFF4940 in Variovorax sp. SCN45

Annotation: FIG033889: YebC paralog in Betaproteobacteria

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 PF20772: TACO1_YebC_N" amino acids 6 to 70 (65 residues), 79.4 bits, see alignment E=2.4e-26 PF01709: Transcrip_reg" amino acids 78 to 232 (155 residues), 143.5 bits, see alignment E=5.1e-46

Best Hits

Swiss-Prot: 84% identical to Y2928_POLSJ: Probable transcriptional regulatory protein Bpro_2928 (Bpro_2928) from Polaromonas sp. (strain JS666 / ATCC BAA-500)

KEGG orthology group: None (inferred from 95% identity to vpe:Varpa_0401)

Predicted SEED Role

"FIG033889: YebC paralog in Betaproteobacteria"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (237 amino acids)

>GFF4940 FIG033889: YebC paralog in Betaproteobacteria (Variovorax sp. SCN45)
MGAQWKAKHKDLAANAKGRLFGKLAKEIMMAARNGADPAGNSRLRLVVEQARKVSMPKDT
LDRAIKKGAGLTGEAVHFEHVIYEGFAPHRVPVMVECLTDNVNRTAPEMRVLFRKGQLGT
SGSVSWDFDHVGMIEAEPAKPDADPEVAAIEAGAQDFEPAGEGNSSIFLTDPTDLDLVSR
ALPAQGFTVLSAKLGYKPKNPVDPASLSAEDLEEVETFLAAIDANDDVQNVFVGLAG