Protein Info for PS417_25315 in Pseudomonas simiae WCS417

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF03922: OmpW" amino acids 24 to 232 (209 residues), 212 bits, see alignment E=1.2e-66 PF13505: OMP_b-brl" amino acids 32 to 232 (201 residues), 56.4 bits, see alignment E=6.6e-19 PF02462: Opacity" amino acids 123 to 207 (85 residues), 26.9 bits, see alignment E=6.8e-10

Best Hits

Swiss-Prot: 42% identical to OMPW_SHIFL: Outer membrane protein W (ompW) from Shigella flexneri

KEGG orthology group: K07275, outer membrane protein (inferred from 97% identity to pfs:PFLU5483)

Predicted SEED Role

"Outer membrane protein W precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U7D4 at UniProt or InterPro

Protein Sequence (232 amino acids)

>PS417_25315 membrane protein (Pseudomonas simiae WCS417)
MNKSLLGASLFALALVAPVVHAHEAGDILVRAGAITVNPKADSGHVKVDQGPLAGANLGG
KATMSSDTQLGLNFAYMLTNHVGIELLAATPFEHDVKIKNTALGAANGKLGTLKHLPPTL
SIVYYPLDNKSAFQPYVGAGINYTWIYDEHVGSRAQGAGFSNFKAENSWGWAAQIGADYM
INDKWMINAQARYIDISTKATVDNNALGQGTRAKVNVDVDPMVYMVGIGYKF