Protein Info for PS417_25280 in Pseudomonas simiae WCS417

Annotation: methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 PF10294: Methyltransf_16" amino acids 62 to 168 (107 residues), 41.1 bits, see alignment E=5.8e-14 PF05175: MTS" amino acids 73 to 149 (77 residues), 37.3 bits, see alignment E=8e-13 PF02475: Met_10" amino acids 81 to 130 (50 residues), 21.3 bits, see alignment E=7.2e-08 PF06325: PrmA" amino acids 81 to 152 (72 residues), 54.4 bits, see alignment E=4.7e-18 PF13847: Methyltransf_31" amino acids 82 to 161 (80 residues), 28.5 bits, see alignment E=4.2e-10 PF13649: Methyltransf_25" amino acids 85 to 165 (81 residues), 31.3 bits, see alignment E=9.8e-11 PF08241: Methyltransf_11" amino acids 86 to 154 (69 residues), 24.1 bits, see alignment E=1.7e-08

Best Hits

KEGG orthology group: None (inferred from 96% identity to pfs:PFLU5476)

Predicted SEED Role

"Glutamate synthase [NADPH] large chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13

Use Curated BLAST to search for 1.4.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U202 at UniProt or InterPro

Protein Sequence (218 amino acids)

>PS417_25280 methyltransferase (Pseudomonas simiae WCS417)
MTPPLDLQAALSGLIGDAQLVPCPLPGTALSLWLLDADNMDRAFSPEETRRILHEPPYWS
FCWASGLALARYLAANPEWVAGKRVLDFGAGSGVAGIAAAKAGAREVVACDLDPLALASC
RANAELNGVALGYSADFFAEADRFDLILVADVLYDRANLPLLDQFLTRGREALVADSRVR
DFQHPDYQRLEILDALTLPDLAEPWEFRKVSLYHSRRA