Protein Info for GFF4926 in Xanthobacter sp. DMC5

Annotation: IS3 family transposase ISRle5

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 PF13276: HTH_21" amino acids 37 to 87 (51 residues), 52.8 bits, see alignment 5.8e-18 PF00665: rve" amino acids 105 to 202 (98 residues), 77 bits, see alignment E=1.8e-25 PF13683: rve_3" amino acids 191 to 256 (66 residues), 100.1 bits, see alignment E=7.1e-33

Best Hits

KEGG orthology group: K07497, putative transposase (inferred from 84% identity to gdi:GDI_2840)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (269 amino acids)

>GFF4926 IS3 family transposase ISRle5 (Xanthobacter sp. DMC5)
VDRLRDDWKVSARRACATLAVDRALYAYKSKRGAQAELNQRIKEICETRVRYGYRRVHIL
LRREGWSVNPKRIYRLYKDLGLQLRNKVPKRRVKAKLRDDRHPATRSNETWAMDFVHDQL
ATGRKIRVLTIVDTFTRFSPAVDPRFSYRGEDVVLTLERICRSMGYPQSIRVDQGSEFVS
RDLDLWAYQKGVVLDFSRPGKPTDNGFIESFNGKFRAECLNTHWFMSLDDARAKMEAWRR
DYNEVRPHSAIGNKPPIALMNGSPASPPA