Protein Info for GFF4923 in Variovorax sp. SCN45

Annotation: Substrate-specific component BioY of biotin ECF transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 196 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 36 to 54 (19 residues), see Phobius details amino acids 60 to 78 (19 residues), see Phobius details amino acids 86 to 111 (26 residues), see Phobius details amino acids 123 to 151 (29 residues), see Phobius details amino acids 159 to 182 (24 residues), see Phobius details PF07155: ECF-ribofla_trS" amino acids 9 to 62 (54 residues), 29.7 bits, see alignment E=6.2e-11 PF02632: BioY" amino acids 37 to 185 (149 residues), 120.5 bits, see alignment E=5.3e-39

Best Hits

Swiss-Prot: 45% identical to BIOY_BACSU: Probable biotin transporter BioY (bioY) from Bacillus subtilis (strain 168)

KEGG orthology group: K03523, putative biotin biosynthesis protein BioY (inferred from 93% identity to vpe:Varpa_0405)

Predicted SEED Role

"Substrate-specific component BioY of biotin ECF transporter" in subsystem Biotin biosynthesis or ECF class transporters

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (196 amino acids)

>GFF4923 Substrate-specific component BioY of biotin ECF transporter (Variovorax sp. SCN45)
MTTTGSLTSSRSLSYIALFAALMAVFGLIPKIDLPFGVPITLQSLGVMLAGCLLGPRRGF
LAIALFLLAVALGLPLLPGGRGGLSVFVAPAGGFLFGWMFGAFACGLLMRLAMRRMAGAT
GLPLLAAAFLSSVVGGIGVVYAFGIVGLSLIAHMSLSQAALAMLVFIPGDLIKCGICAML
VQTVMRGMPGWRLDRD