Protein Info for PS417_25220 in Pseudomonas simiae WCS417

Annotation: iron-hydroxamate ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF01497: Peripla_BP_2" amino acids 23 to 216 (194 residues), 95.5 bits, see alignment E=1.7e-31

Best Hits

Swiss-Prot: 35% identical to BTUF_VIBC3: Vitamin B12-binding protein (btuF) from Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)

KEGG orthology group: None (inferred from 92% identity to pfs:PFLU5464)

Predicted SEED Role

"Vitamin B12 ABC transporter, B12-binding component BtuF" in subsystem Coenzyme B12 biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7ULK8 at UniProt or InterPro

Protein Sequence (262 amino acids)

>PS417_25220 iron-hydroxamate ABC transporter substrate-binding protein (Pseudomonas simiae WCS417)
MRRHWLAVLLLAFCAQTLAAERVVSLAPSLSEIVVELGAADLLVGVLDGGDRPVALAQVP
SVGHYGQLDMERLLSLKPDLILLWPGSVGPAQREQLQRLNIPIYVAEPHSLEQLTTQVQA
IAEQLGRPESGRQLAAHLRQRLADLRQRYQRVEPLRVFYQVWNQPLYTVGGGQIISDALS
VCGARNVFDDLKLPAPQVSIESVLQRDPELILVGDQAQREAWKVWPAMAERVRLVPDKGL
ERPSGQMLEAVARLCQVIAPNK