Protein Info for GFF4920 in Variovorax sp. SCN45

Annotation: Isochorismatase family protein YecD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00857: Isochorismatase
  • amino acids 38 to 211 (174 residues), 144.4 bits, E=2.1e-46

Best Hits

KEGG orthology group: K05993, isochorismatase [EC: 3.3.2.1] (inferred from 67% identity to bph:Bphy_0542)

Predicted SEED Role

"Nicotinamidase/isochorismatase family protein" in subsystem NAD and NADP cofactor biosynthesis global

MetaCyc Pathways

• superpathway of chorismate metabolism (42/59 steps found)
• 2,3-dihydroxybenzoate biosynthesis (1/3 steps found)
• enterobactin biosynthesis (4/11 steps found)
• vibriobactin biosynthesis (1/9 steps found)
• bacillibactin biosynthesis (3/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of phenylpropanoids
• Biosynthesis of siderophore group nonribosomal peptides

Isozymes

Compare fitness of predicted isozymes for: 3.3.2.1

Use Curated BLAST to search for 3.3.2.1

Protein Sequence (225 amino acids)

>GFF4920 Isochorismatase family protein YecD (Variovorax sp. SCN45)
MLLHGPAFSHAALIAGSYGVRIMVCMQIQLPDLDPRQTALISIDLQNSNVARQLAPHSAA
EVVQRGKRIADSLREAGGTVVWVRVDVTALLSLPADASISRPAGSPVPPPEFSELVPELE
VQAADVRITKRQWGAFYGTDLDQQLRRRGIKTLLMSGIATNFGVESTARAAFDRGYELVF
VEDAMTSLAAEPHDFANKQVFPRMGRVRSTDVVLAAIAAAAGQQR