Protein Info for PS417_25205 in Pseudomonas simiae WCS417

Annotation: 1-deoxy-D-xylulose-5-phosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 632 PF13292: DXP_synthase_N" amino acids 18 to 289 (272 residues), 399.1 bits, see alignment E=2.4e-123 TIGR00204: 1-deoxy-D-xylulose-5-phosphate synthase" amino acids 23 to 627 (605 residues), 875.9 bits, see alignment E=8e-268 PF02775: TPP_enzyme_C" amino acids 128 to 190 (63 residues), 23.9 bits, see alignment E=8.2e-09 PF00676: E1_dh" amino acids 130 to 193 (64 residues), 26.5 bits, see alignment E=7.7e-10 PF02779: Transket_pyr" amino acids 328 to 488 (161 residues), 152.7 bits, see alignment E=2e-48 PF02780: Transketolase_C" amino acids 503 to 619 (117 residues), 94.3 bits, see alignment E=1.4e-30

Best Hits

Swiss-Prot: 99% identical to DXS_PSEFS: 1-deoxy-D-xylulose-5-phosphate synthase (dxs) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K01662, 1-deoxy-D-xylulose-5-phosphate synthase [EC: 2.2.1.7] (inferred from 99% identity to pfs:PFLU5462)

MetaCyc: 63% identical to 1-deoxy-D-xylulose-5-phosphate synthase (Escherichia coli K-12 substr. MG1655)
1-deoxy-D-xylulose-5-phosphate synthase. [EC: 2.2.1.7]

Predicted SEED Role

"1-deoxy-D-xylulose 5-phosphate synthase (EC 2.2.1.7)" in subsystem Isoprenoid Biosynthesis or Pyridoxin (Vitamin B6) Biosynthesis or Thiamin biosynthesis (EC 2.2.1.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.2.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U4E9 at UniProt or InterPro

Protein Sequence (632 amino acids)

>PS417_25205 1-deoxy-D-xylulose-5-phosphate synthase (Pseudomonas simiae WCS417)
MPTTFQEIPRKRPSTPLLDRAVTPAGLRRLGEAELETLADELRLELLYTVGQTGGHFGAG
LGVIELTIALHYVFDTPDDRLVWDVGHQAYPHKILTGRRERMGSLRQKDGIAAFPRRAES
EYDTFGVGHSSTSISAALGMAIAARLQGSDRKAIAVIGDGALTAGMAFEALNHAPEVDAN
MLVILNDNDMSISRNVGGLSNYLAKILSSRTYASMREGSKKVLSRLPGAWEIARRTEEYA
KGMLVPGTLFEELGWNYIGPIDGHDLPTLIATLRNMRDLKGPQFLHIVTKKGKGFAPAEV
DPIGYHAITKLEPVDAPAAAPKKASGPKYSGVFGEWLCDMAAADPRLVGITPAMKEGSDL
VAFSERFPLRYFDVAIAEQHAVTFAAGMACEGAKPVVAIYSTFLQRGYDQLVHDVAVQNL
DVLFAIDRAGLVGEDGPTHAGSFDLSYLRCIPGMLVMTPSDENELRKMLSTGHLYNGPAA
VRYPRGNGPNAVIEKDLEPIEIGKGIVRRQGSKTAFLVFGVQLAEALKVAEKIDATVVDM
RFVKPLDEALVREIAGSHELLVTVEENAIMGGAGAAVSEFLARENILKSVLHLGLPDVYV
EHAKPAQMLAECGLDEAGIEASVRERMALLGL