Protein Info for GFF4912 in Variovorax sp. SCN45

Annotation: tRNA-specific 2-thiouridylase MnmA (EC 2.8.1.13)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 PF03054: tRNA_Me_trans" amino acids 4 to 201 (198 residues), 269.9 bits, see alignment E=2.8e-84 PF02540: NAD_synthase" amino acids 4 to 75 (72 residues), 26 bits, see alignment E=9.8e-10 TIGR00420: tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase" amino acids 5 to 368 (364 residues), 423.9 bits, see alignment E=2.2e-131 PF20259: tRNA_Me_trans_M" amino acids 206 to 281 (76 residues), 73 bits, see alignment E=2.3e-24 PF20258: tRNA_Me_trans_C" amino acids 291 to 368 (78 residues), 62 bits, see alignment E=1.1e-20

Best Hits

Swiss-Prot: 84% identical to MNMA_ACIAC: tRNA-specific 2-thiouridylase MnmA (mnmA) from Acidovorax citrulli (strain AAC00-1)

KEGG orthology group: K00566, tRNA-specific 2-thiouridylase [EC: 2.8.1.-] (inferred from 95% identity to vpe:Varpa_0413)

Predicted SEED Role

"tRNA-specific 2-thiouridylase MnmA"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (369 amino acids)

>GFF4912 tRNA-specific 2-thiouridylase MnmA (EC 2.8.1.13) (Variovorax sp. SCN45)
MAKQRIVVGLSGGVDSAVTAHLLKQQGHEVVGIFMKNWEDDDDSEYCSSNIDFVDAASVA
DVLGIEIEHVNFAADYKDRVFAEFLREYKAGRTPNPDVLCNAEIKFKAFLDHAMRLGAEK
IATGHYARVRRNDATGKHELLKGLDPSKDQSYFLHRLNQAQLSKTLFPVGELHKTEVRRI
AEEIGLPNAKKKDSTGICFIGERPFRDFLNRYISKEPGPIKDDRGRKLGEHQGLSFYTLG
QRQGLGIGGVKEKGAQRGSGDHSPWFVARKDVEKNTLWVVQGHDHPWLLSSELKADDASW
VSGEAPAAGSYGSKARYRQADAACEMGAGEGGNQAAFSLRFGEPQWAVTPGQSAVLYDGE
RCLGGGVIV