Protein Info for GFF4911 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Undecaprenyl diphosphate synthase (EC 2.5.1.31)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 TIGR00055: di-trans,poly-cis-decaprenylcistransferase" amino acids 5 to 225 (221 residues), 252.7 bits, see alignment E=1.4e-79 PF01255: Prenyltransf" amino acids 12 to 225 (214 residues), 270.5 bits, see alignment E=5.4e-85

Best Hits

Swiss-Prot: 58% identical to ISPT_CHRVO: Isoprenyl transferase (uppS) from Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)

KEGG orthology group: K00806, undecaprenyl diphosphate synthase [EC: 2.5.1.31] (inferred from 70% identity to vpe:Varpa_3323)

MetaCyc: 48% identical to ditrans,polycis-undecaprenyl-diphosphate synthase [(2E,6E)-farnesyl-diphosphate specific] (Escherichia coli K-12 substr. MG1655)
Di-trans,poly-cis-decaprenylcistransferase. [EC: 2.5.1.31]

Predicted SEED Role

"Undecaprenyl diphosphate synthase (EC 2.5.1.31)" (EC 2.5.1.31)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (246 amino acids)

>GFF4911 Undecaprenyl diphosphate synthase (EC 2.5.1.31) (Hydrogenophaga sp. GW460-11-11-14-LB1)
VPAKLPGHVAIVMDGNGRWAQKRWLPRAAGHKQGVDALREVVKACIERGVGVLSVFAFSS
ENWNRPVEEVSGLMDLLAMALSREVPSLKKSGVQLHFPGNRGGLSARVVQGLEAAERETA
HNRTLVLNVCFNYGGRWDIAQAARRLAQQGVEITEESLSGAMALAHVDDPDLLIRTGGEL
RISNFLLWQSAYTELLFTDCLWPDFDAAELDRALVEFARRERRFGQTAEQRAEVEPEAAA
MSQRHA