Protein Info for GFF4910 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Phosphatidate cytidylyltransferase (EC 2.7.7.41)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 31 to 46 (16 residues), see Phobius details amino acids 53 to 72 (20 residues), see Phobius details amino acids 79 to 98 (20 residues), see Phobius details amino acids 109 to 128 (20 residues), see Phobius details amino acids 134 to 155 (22 residues), see Phobius details amino acids 176 to 194 (19 residues), see Phobius details amino acids 206 to 227 (22 residues), see Phobius details PF01148: CTP_transf_1" amino acids 3 to 272 (270 residues), 175.2 bits, see alignment E=1.2e-55

Best Hits

KEGG orthology group: K00981, phosphatidate cytidylyltransferase [EC: 2.7.7.41] (inferred from 60% identity to rfr:Rfer_1993)

Predicted SEED Role

"Phosphatidate cytidylyltransferase (EC 2.7.7.41)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.7.41)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.41

Use Curated BLAST to search for 2.7.7.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (273 amino acids)

>GFF4910 Phosphatidate cytidylyltransferase (EC 2.7.7.41) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MLKQRIITALLLLAVLLPALFYPSIEPFAALTLLLIVAGGWEWARLNGCGSSLSLGLGFG
LGVLMALVWWAGGLSLTLRPLWLTVGAAWVLLAVVMLGRGVKGWGAWPVGLRLPVGLVLI
ACAWLAMVHARLVGLEFLLSVLLLVWMADIAAYFGGKAFGRRKLAPAISPGKSWEGAISG
LLGVFLLAACWLWADGQGASLYARLWALGPMLAVLSLVFLVAMSVVGDLVESLVKRSAGA
KDSSQLLPGHGGVLDRVDALLPVLPLAMMLITV