Protein Info for GFF4908 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Membrane-associated zinc metalloprotease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 95 to 116 (22 residues), see Phobius details amino acids 381 to 402 (22 residues), see Phobius details amino acids 431 to 450 (20 residues), see Phobius details TIGR00054: RIP metalloprotease RseP" amino acids 1 to 452 (452 residues), 318.1 bits, see alignment E=4.3e-99 PF02163: Peptidase_M50" amino acids 6 to 440 (435 residues), 212.3 bits, see alignment E=8.7e-67 PF00595: PDZ" amino acids 226 to 258 (33 residues), 25.5 bits, see alignment (E = 2.2e-09) PF17820: PDZ_6" amino acids 226 to 270 (45 residues), 36.3 bits, see alignment 5.8e-13

Best Hits

KEGG orthology group: K11749, regulator of sigma E protease [EC: 3.4.24.-] (inferred from 69% identity to pol:Bpro_2688)

Predicted SEED Role

"Membrane-associated zinc metalloprotease" in subsystem Sex pheromones in Enterococcus faecalis and other Firmicutes

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (454 amino acids)

>GFF4908 Membrane-associated zinc metalloprotease (Hydrogenophaga sp. GW460-11-11-14-LB1)
MLTLVAFVVALGLLIAVHEYGHYRVAVACGVKVLRFSVGFGKPLLTWRKKGSPTEFVLCA
LPLGGYVRMLDEREALVDPAERHLAFNTQPLRSRAAIVAAGPAANLLLAIAIYALVNWTG
VEEPKPVLASPVAGSIAERAGLRGGEWVAQTAAADAEASAVASFEDLRWRLTQAALSSED
MTLWVSSREGDATRPVTLPLSQLDVREADAALFQRIGITSPWSAPVVGEVMEGGAAAAAG
LREGDLVRRVNDQPLGDGQSLRALIRAATGPAGEPVEQRWEVSRGGQLLTLVVRPMPEQQ
SGVWIGRVGAYIGAMPEMTTVRHGPVDGLVNGVVRTWEVSWLTLKMMGRMLIGEASVKNL
SGPLTIADYAGKSASLGITSYLLFLALISVSLGVLNLLPLPVLDGGHLMYYLWEGVTGRS
VSDVWMERLQRGGVVVLMALMSVALFNDVARLAG