Protein Info for GFF4905 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Macrolide-specific efflux protein MacA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 41 to 363 (323 residues), 184 bits, see alignment E=1.8e-58 PF16576: HlyD_D23" amino acids 50 to 295 (246 residues), 55.1 bits, see alignment E=1.3e-18 PF13533: Biotin_lipoyl_2" amino acids 63 to 109 (47 residues), 31.6 bits, see alignment 2.3e-11 PF13437: HlyD_3" amino acids 187 to 285 (99 residues), 50.6 bits, see alignment E=5.8e-17

Best Hits

Swiss-Prot: 84% identical to MACA_SHIFL: Macrolide export protein MacA (macA) from Shigella flexneri

KEGG orthology group: K13888, macrolide-specific efflux protein MacA (inferred from 99% identity to sew:SeSA_A1059)

MetaCyc: 83% identical to ABC-type tripartite efflux pump membrane fusion protein (Escherichia coli K-12 substr. MG1655)
7.6.2.-; 7.6.2.-; 7.6.2.-

Predicted SEED Role

"Macrolide-specific efflux protein MacA" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (372 amino acids)

>GFF4905 Macrolide-specific efflux protein MacA (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MRAKGKKFKKRYLVIILILLVGGMAGWRMINAPLPTYQTLIVRPGDLEQSVLATGKLDAL
RKVDVGAQVSGQLKTLLVSIGDNVKKDQLLGVIDPDQAENQIKEVEATLMELNAERQQAA
AELKLARVTLARQQQLAKTQAVSQQDLDTAATEMAVKQARIGTIDAQIKRNRASLDTAKT
NLEYTRIVAPMAGEVTQITTLQGQTVIAAQQAPNILTLADMSTMLVKAQVSEADVIHLRA
GQKAWFTIAGDPQTRYEGVLKDILPTPEKINDAIFYYARFEVPNPKRILRLDMTAQVYIQ
LMDVKNVLIIPLAALGEPVGGNRYKVALLRNGEKREREVVIGERNDTDVEVVKGLEAGDE
VIIGESRPGATP