Protein Info for GFF4904 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 51 to 76 (26 residues), see Phobius details amino acids 91 to 109 (19 residues), see Phobius details amino acids 262 to 286 (25 residues), see Phobius details amino acids 296 to 320 (25 residues), see Phobius details amino acids 341 to 359 (19 residues), see Phobius details PF03824: NicO" amino acids 15 to 125 (111 residues), 63.4 bits, see alignment E=2.2e-21 amino acids 229 to 360 (132 residues), 79.5 bits, see alignment E=2.7e-26 PF13386: DsbD_2" amino acids 253 to 334 (82 residues), 26.9 bits, see alignment E=4.2e-10

Best Hits

KEGG orthology group: K08970, nickel/cobalt exporter (inferred from 81% identity to xau:Xaut_3402)

Predicted SEED Role

"Inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (381 amino acids)

>GFF4904 hypothetical protein (Xanthobacter sp. DMC5)
MTPFTDLVQQGAAHAWLFIPSAILLGALHGLEPGHSKTMMAAFVIAIRGTVAQAVLLGLA
ATASHTAIVWIIALGGQYFGQQWGGEASEPYFQLASAAVIIAVAAWMAWRTWREQAWSEQ
ACEHHHPHDDEVRLVATGEGTIALEIFEDGVPPRWRISSPSGAGFPDAERLRVETLRPGG
IRQVFSFADRGGFLESRQEIPEPHAFAATLRLARADGGQEVHDLAFEEHDHAHMNLGDED
DAHARAHAADIRKRFAGRPVTTWQIVAFGLTGGLIPCPAAITVLLICMQLKQLSLGFVLV
LCFSVGLALTLVSAGVLAALSFRHVSQRWSGFSAFARRAPYASAALILVVGIYTGWLGWH
GLTREPATLAAISGPMLPHHP