Protein Info for GFF4904 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Macrolide export ATP-binding/permease protein MacB (EC 3.6.3.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 648 transmembrane" amino acids 273 to 295 (23 residues), see Phobius details amino acids 419 to 436 (18 residues), see Phobius details amino acids 522 to 548 (27 residues), see Phobius details amino acids 572 to 601 (30 residues), see Phobius details amino acids 607 to 631 (25 residues), see Phobius details PF00005: ABC_tran" amino acids 24 to 172 (149 residues), 118.2 bits, see alignment E=6.4e-38 PF12704: MacB_PCD" amino acids 272 to 491 (220 residues), 157.4 bits, see alignment E=9.7e-50 PF02687: FtsX" amino acids 527 to 641 (115 residues), 60.8 bits, see alignment E=2e-20

Best Hits

Swiss-Prot: 100% identical to MACB_SALTY: Macrolide export ATP-binding/permease protein MacB (macB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K05685, macrolide transport system ATP-binding/permease protein [EC: 3.6.3.-] (inferred from 100% identity to spq:SPAB_02581)

MetaCyc: 83% identical to ABC-type tripartite efflux pump ATP binding/membrane subunit (Escherichia coli K-12 substr. MG1655)
7.6.2.-; 7.6.2.-; 7.6.2.-

Predicted SEED Role

"Macrolide export ATP-binding/permease protein MacB (EC 3.6.3.-)" in subsystem Multidrug Resistance Efflux Pumps (EC 3.6.3.-)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (648 amino acids)

>GFF4904 Macrolide export ATP-binding/permease protein MacB (EC 3.6.3.-) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MTALLELCNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKP
TSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIERKK
RQARARELLLRLGLSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSG
EEVMAILRQLRDRGHTVIIVTHDPLIAAQAERIIEIHDGKIVHNPPAQEKKREQGVDAAV
VNTAPGWRQFASSFREALSMAWLAMAANKMRTLLTMLGIIIGIASVVSIVVVGDAAKQMV
LADIRAMGTNTIDIHPGKDFGDDNPQYRQALKYDDLVAIQKQPWVNSATPSVSKSLRLRY
GNIDIAVNANGVSGDYFNVYGMSFREGNTFNAVQQQDRAQVVVLDANTRRQLFPNKANVV
GEVVLAGNMPVIVIGVAEEKPSMYGNSNLLQVWLPYSTMSDRIMGQSWLNSITVRVKDGV
DSDQAEQQLTRLLTLRHGKKDFFTWNMDSVLKTAEKTTYTLQLFLTLVAVISLVVGGIGV
MNIMLVSVTERTREIGIRMAVGARASDVLQQFLIEAVLVCLVGGALGISLSMFIAFMLQL
FLPGWEIGFSLTALASAFLCSTFTGILFGWLPARNAARLDPVDALARE