Protein Info for GFF4901 in Sphingobium sp. HT1-2

Annotation: Oxidoreductase, short-chain dehydrogenase/reductase family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF00106: adh_short" amino acids 8 to 195 (188 residues), 139.2 bits, see alignment E=1.8e-44 PF08659: KR" amino acids 9 to 188 (180 residues), 33.4 bits, see alignment E=6.8e-12 PF13561: adh_short_C2" amino acids 15 to 245 (231 residues), 168.1 bits, see alignment E=3.8e-53

Best Hits

KEGG orthology group: K00059, 3-oxoacyl-[acyl-carrier protein] reductase [EC: 1.1.1.100] (inferred from 36% identity to mno:Mnod_3752)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (253 amino acids)

>GFF4901 Oxidoreductase, short-chain dehydrogenase/reductase family (Sphingobium sp. HT1-2)
MAGRFVGKTVLVTGGAAGLGRAYALAFGGEGAHLILADINEAGLAESKALVEQLGATAAV
HRVDMSDEADIQAFAADVLAVHDRLDVLINNAGLHLGEIARGFFGLGQAKWQHYFAVNTI
GPLLLAEALRPALAKAKGVIINKSSMASYNPATAYGITKAALNIFTHAMAMQFGQDEIRC
VGIAPGLMATEAAQDGVAADNWERLKGMQSVKRQGTAEDIANLGLFLASDEGSFINNQVI
LCDGGNQMRGFRF