Protein Info for GFF490 in Sphingobium sp. HT1-2

Annotation: UPF0145 protein YbjQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 108 PF01906: YbjQ_1" amino acids 4 to 107 (104 residues), 129.1 bits, see alignment E=4.8e-42

Best Hits

Swiss-Prot: 75% identical to Y338_SPHAL: UPF0145 protein Sala_0338 (Sala_0338) from Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)

KEGG orthology group: None (inferred from 86% identity to sch:Sphch_2864)

Predicted SEED Role

"PlcB, ORFX, ORFP, ORFB, ORFA, ldh gene"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (108 amino acids)

>GFF490 UPF0145 protein YbjQ (Sphingobium sp. HT1-2)
MTDIIVSTTSRLEGRPAQDYLGIVTGEVIVGANLFRDLFASVRDIVGGRSGAYEDVLQRA
RSEAIEEMRGNARKLGANAVVGVDLDYEVIGANGSMLMVSASGTAIRY