Protein Info for GFF49 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 531 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 30 to 51 (22 residues), see Phobius details amino acids 63 to 85 (23 residues), see Phobius details amino acids 98 to 117 (20 residues), see Phobius details amino acids 155 to 172 (18 residues), see Phobius details amino acids 186 to 206 (21 residues), see Phobius details amino acids 213 to 229 (17 residues), see Phobius details amino acids 235 to 252 (18 residues), see Phobius details amino acids 264 to 288 (25 residues), see Phobius details amino acids 427 to 450 (24 residues), see Phobius details amino acids 462 to 480 (19 residues), see Phobius details amino acids 500 to 518 (19 residues), see Phobius details

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (531 amino acids)

>GFF49 hypothetical protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
VSNARFILLSLMALATLALAAQMAIDFSTVNIGSACIVFASSIAMLLYLLWTPALHTHPL
STFALFGFCVTTQLGALLGQTVFGASLAQNLRQPMETFATLAGFQAVAALGHMLYRWFLH
PAPQPSAVEPPLEAAPSFIRQLLGKLGLYEAPPTSALWLMGYVGLFAFLISGGSEGTFRK
VLDGMRFLTWAPFLIPMYLIQVGPAYCRPRRQYLHLLCFGSLVVLLGLAANVRSIMLSGF
VTIALFALLTALRSQAPVSGKRCLQLGVLGLVLGAVAIPMTDLATAMVVARKVRGGVSAV
DMVKETLYYFQRPELLAQQERIQRDAATLDKYDEYYFENPLLARLMETKFHDNSLYFVSR
FSQSDTARLADTSVDLMWSILPNPALKALGVDVNKRDLEFSMGDYLSHLSQGGPLGGYRT
GSMLAQGLALLGVGFAIVYFFACLGVFALLDLLSYRSRSGQVLLTTVGMLSIWKIFQYGL
TADALHAWVSLVFRELPQQVFFFFLITTFVRCLGLVFHGHARATTVHGISP