Protein Info for GFF49 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: 1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC 1.1.1.267)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 TIGR00243: 1-deoxy-D-xylulose 5-phosphate reductoisomerase" amino acids 30 to 425 (396 residues), 630.1 bits, see alignment E=6.4e-194 PF02670: DXP_reductoisom" amino acids 33 to 161 (129 residues), 169.5 bits, see alignment E=8.2e-54 PF08436: DXP_redisom_C" amino acids 175 to 268 (94 residues), 122 bits, see alignment E=1.3e-39 PF13288: DXPR_C" amino acids 300 to 416 (117 residues), 138.8 bits, see alignment E=1.5e-44

Best Hits

Swiss-Prot: 100% identical to DXR_SALTY: 1-deoxy-D-xylulose 5-phosphate reductoisomerase (dxr) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K00099, 1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC: 1.1.1.267] (inferred from 99% identity to sew:SeSA_A0245)

MetaCyc: 89% identical to 1-deoxy-D-xylulose 5-phosphate reductoisomerase (Escherichia coli K-12 substr. MG1655)
1-deoxy-D-xylulose-5-phosphate reductoisomerase. [EC: 1.1.1.267]

Predicted SEED Role

"1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC 1.1.1.267)" in subsystem Isoprenoid Biosynthesis or polyprenyl synthesis (EC 1.1.1.267)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.267

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (427 amino acids)

>GFF49 1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC 1.1.1.267) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
VYKAPRRRHYQVSCAAFCFLFRFNTSGRFMKQLTILGSTGSIGCSTLDVVRHNPDSFRVI
ALVAGKNVARMAEQCLEFSPRYAVMDDTSSAEQLKIMLQQHGSRTEVLSGQQAACEMAAL
DEVGHVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRLFMDEVKRSNARLLPVDS
EHNAIFQSLPQSIQHNLGYADLEQNGVTSILLTGSGGPFRETPMCDLAAMTPDQACRHPN
WSMGRKISVDSATMMNKGLEYIEARWLFNASARQMEVLIHPQSVIHSMVRYQDGSVLAQL
GEPDMRTPIAHTMAWPNRVTSGAQPLDFCKLSALTFSAPDYQRYPCLKLAMEAFEQGQAA
TTALNAANEITVAAFLAQQIRFTDIAGLNLAVLERMDLQEPASVEDVLQVDAIAREVARK
QVIRLSR