Protein Info for PS417_25100 in Pseudomonas simiae WCS417

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 transmembrane" amino acids 15 to 37 (23 residues), see Phobius details amino acids 47 to 66 (20 residues), see Phobius details amino acids 77 to 98 (22 residues), see Phobius details amino acids 110 to 128 (19 residues), see Phobius details amino acids 282 to 301 (20 residues), see Phobius details TIGR03025: exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase" amino acids 29 to 460 (432 residues), 437.3 bits, see alignment E=8.4e-135 TIGR03023: undecaprenyl-phosphate glucose phosphotransferase" amino acids 32 to 460 (429 residues), 442 bits, see alignment E=3.4e-136 PF13727: CoA_binding_3" amino acids 72 to 237 (166 residues), 71.9 bits, see alignment E=6.8e-24 PF02397: Bac_transf" amino acids 275 to 458 (184 residues), 222.4 bits, see alignment E=3.3e-70

Best Hits

KEGG orthology group: K03606, putative colanic acid biosysnthesis UDP-glucose lipid carrier transferase (inferred from 60% identity to pfo:Pfl01_3829)

Predicted SEED Role

"Undecaprenyl-phosphate galactosephosphotransferase (EC 2.7.8.6)" (EC 2.7.8.6)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UCS9 at UniProt or InterPro

Protein Sequence (463 amino acids)

>PS417_25100 hypothetical protein (Pseudomonas simiae WCS417)
MEHLRFDRSASLRGLTFWIQWLVASTLLIGLLILLTLYRTGGIDSHYRYLTLLTLLGSVP
AYSLMQVYHKHHSYFRGLIRLFYGWSILLMGLTSVGFISKTSQYFSREVFILWGVLGFAC
QALVYVPLHALRRRYRQNVEAQYKTLIVGTDDLALDLARKFSSRARASLVGLVSTRGDMA
ASAENFRVVGNIQQLPELISWYEIRRLYIAISLSEVNQIEALYIELLDTNVDVVWIPDLQ
SMSLLNHSISEMDGVPAIHLNESPLITYPMSALSKDLLDRSVALLALVTLSPLLIATAIA
VKCSSPGPILFKQRRHGWNGKVIKIWKFRSMRLHDSTEVRQAIRDDPRTTRVGRFIRRSS
IDELPQLFNVLQGRMSLVGPRPHAIEHNDFYTGKIIAYLARHRIKPGITGLAQIRGYRGE
TETLDKMQRRVEIDLEYINNWSLWLDVKILIKTPFKLFSKNIY