Protein Info for GFF4892 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Probable two-component transmembrane sensor histidine kinase transcription regulator protein (EC 2.7.3.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 851 transmembrane" amino acids 35 to 58 (24 residues), see Phobius details amino acids 287 to 310 (24 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 328 to 451 (124 residues), 93.7 bits, see alignment E=4.8e-31 PF13188: PAS_8" amino acids 329 to 384 (56 residues), 33.1 bits, see alignment 1.2e-11 PF00989: PAS" amino acids 329 to 441 (113 residues), 65 bits, see alignment E=1.9e-21 PF08448: PAS_4" amino acids 343 to 446 (104 residues), 44.4 bits, see alignment E=5.3e-15 PF13426: PAS_9" amino acids 344 to 443 (100 residues), 50.4 bits, see alignment E=7e-17 PF00512: HisKA" amino acids 597 to 664 (68 residues), 36.2 bits, see alignment E=1.5e-12 PF02518: HATPase_c" amino acids 709 to 826 (118 residues), 71.1 bits, see alignment E=3.1e-23

Best Hits

KEGG orthology group: None (inferred from 70% identity to pol:Bpro_2673)

Predicted SEED Role

"Probable two-component transmembrane sensor histidine kinase transcription regulator protein (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (851 amino acids)

>GFF4892 Probable two-component transmembrane sensor histidine kinase transcription regulator protein (EC 2.7.3.-) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MIPLPETTPPNSAPAQAVWWKRWWRRLPPSRQDRFATLGPLLAVLLFLSAIVVAITYLRY
EELEREQEAVTRDVEYAQQRLRLRLLERQEQLMRLAREVGNKEIESEEFEFQVESLVSQF
PEMLAISWVDGRRNVLATYASPSAPAALVRPIGTVLTPGETDGSFDLARDLRQPIYSRPL
GEDARNSTLMLHVPLSEQGRFSGTIMGEYSIDGLMRFGIPPEIMARYAVALVDDRGRVLA
GSLQTPSTVLRLLPWSNPPLEHEVPVSPVGNGLILKAQGYRTSQDIVGSGFFWVIGALSA
LTVWMLLGTWRHTRRRVQAQQALVAETNFRRAMENSMLTGMRALDMQGRITYVNPAFCSM
TGWTEGELVGRTAPFPYWPEEEHDQLAARLEDELRGRSTPGGFEVHVKRRDGSIFDARMY
VSPLIDPKGHQTGWMTSMTDITEPKRIREELSASYERFTTVLESLDSAVSVAPLGSDEML
FANKMYRLWFGTRGQGHRHLVDLAGNQPSPSPDDGDAVDAFAGMPTETLTDAGAENAEVF
VEELDRWLEVRTRYLTWVDGRLAQMVIASDITPRRYAEEQASRQAERAQTASRLITMGEM
ASSVAHELNQPLTAITNYCNGMISRVTEQRITTDELLGALEKTSRQAQRAGQIIQRIRAF
VKRSEPNPTLSDVAQMVSNAIELADIELRRHQVRLSPYVAARLPNLMVDPILIEQVLINL
LKNAGEAIAQAGRAPGERYVELRVGPRRLDDVDVVEFSVRDSGNGVPDEMIERIYEAFYS
TKSEGMGIGLKLCRSIVESHHGRMQVQNIYNGEEVVGCCFSFWIPVVSRLQNLSAGAGPA
TESLTDTERAR