Protein Info for GFF4891 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Transport ATP-binding protein CydD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 588 transmembrane" amino acids 29 to 49 (21 residues), see Phobius details amino acids 61 to 81 (21 residues), see Phobius details amino acids 140 to 159 (20 residues), see Phobius details amino acids 165 to 187 (23 residues), see Phobius details amino acids 245 to 270 (26 residues), see Phobius details amino acids 279 to 298 (20 residues), see Phobius details TIGR02857: thiol reductant ABC exporter, CydD subunit" amino acids 21 to 556 (536 residues), 627.1 bits, see alignment E=1.6e-192 PF00664: ABC_membrane" amino acids 26 to 292 (267 residues), 175.2 bits, see alignment E=3.5e-55 PF00005: ABC_tran" amino acids 368 to 513 (146 residues), 103.8 bits, see alignment E=1.9e-33

Best Hits

Swiss-Prot: 91% identical to CYDD_ECOLI: ATP-binding/permease protein CydD (cydD) from Escherichia coli (strain K12)

KEGG orthology group: K06148, ATP-binding cassette, subfamily C, bacterial (inferred from 100% identity to sea:SeAg_B0962)

MetaCyc: 91% identical to glutathione/L-cysteine ABC exporter subunit CydD (Escherichia coli K-12 substr. MG1655)
7.4.2.-; 3.6.3.M9 [EC: 3.6.3.M9]

Predicted SEED Role

"Transport ATP-binding protein CydD" in subsystem Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.M9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (588 amino acids)

>GFF4891 Transport ATP-binding protein CydD (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MNKTRQKELTRWLKQQSVISQRWLNISRLLGFMSGVLIVAQAWIMARILQHMIMENIPRE
ALLLPFILLILVFVLRAWVVWLRERVGFHAGQHIRFEIRRQVLDRLQQAGPAWIQGKPAG
SWATLVLEQIDDMHDYYARYLPQMALAVCVPLLIVAAIFPSNWAAALILLGTAPLIPLFM
AMVGMGAADANRRNFLALARLSGHFLDRLRGMETLRIFGRGEAETESIRAASQDFRQRTM
EVLRLAFLSSGVLEFFTSLSIALVAVYFGFSYLGELNFGHYGTGVTLAAGFLALILAPEF
FQPLRDLGTFYHAKAQAVGAADSLKTFLETPLAHPARGEVELAENEPVTIDAVNLIITSP
EGKTLAGPLNFSLAAGERAVLVGRSGSGKSSLLNVLSGFLSYQGSLRINGVELRDLSPES
WRQHLSWVGQNPQLPAATLRENVLLARPDASEQELYAALDAAWVSEFLPLLPQGVDTPLG
NHASRLSVGQAQRVAVARALLNPCQLLLLDEPAASLDAHSEQRVMQALKAASKRQTTLMV
THQLEDLADWDAIWVMQDGAIVEQGSYAELSAANGAFATLLAHRQEDI