Protein Info for PS417_25060 in Pseudomonas simiae WCS417

Annotation: O-antigen polymerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 transmembrane" amino acids 12 to 27 (16 residues), see Phobius details amino acids 33 to 52 (20 residues), see Phobius details amino acids 72 to 90 (19 residues), see Phobius details amino acids 102 to 120 (19 residues), see Phobius details amino acids 127 to 147 (21 residues), see Phobius details amino acids 177 to 195 (19 residues), see Phobius details amino acids 215 to 232 (18 residues), see Phobius details amino acids 238 to 254 (17 residues), see Phobius details amino acids 263 to 283 (21 residues), see Phobius details amino acids 360 to 383 (24 residues), see Phobius details amino acids 395 to 415 (21 residues), see Phobius details amino acids 421 to 440 (20 residues), see Phobius details PF04932: Wzy_C" amino acids 219 to 374 (156 residues), 70.2 bits, see alignment E=8.8e-24

Best Hits

Predicted SEED Role

"RbmD, similar to Lipid A core - O-antigen ligase and related enzymes"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7ULH7 at UniProt or InterPro

Protein Sequence (460 amino acids)

>PS417_25060 O-antigen polymerase (Pseudomonas simiae WCS417)
MVLSLIRLERMLVFAVLAVIVWLPLPLGSNRDWAIGLMAAFTGGITLAWVAVNLKSGKPV
FGSSATRMVAMPMLALLLACQAWVACQWLFGLSQDNGATFQYLMLGLVYCVLFVMVTGLF
QSRRRLTLLLAVLVISGTVQAFYGAWMTLSGTEWLAFTPKTAYIGDATGSYVNRNHFAGY
LEMTLACGIGLLLALRDKRSFSWVNLLQVLMGPKALLRLALVIMVIALVMSHSRMGNMAF
FASLLIVGGVFVMYERRNRLRNSLILCSLIIIDVLVISQYFGLAQLKDRLVNTRLHDVQV
NNEVVQSANEVRADVFGYAIPLLLERPMAGHGAGTFEAVFQQCPGSNIRLHFDHAHNDYL
QILIEFGLAGSFFLALFVVFALIQAFKALGNRQSIFRSGVGFAACMGIISLLIHSSTDFN
LQIPANATTFVILSAIAVLANTHDHHKRRAHTDVSPAADA