Protein Info for GFF4877 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Cytochrome c heme lyase subunit CcmF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 643 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 40 to 62 (23 residues), see Phobius details amino acids 96 to 114 (19 residues), see Phobius details amino acids 122 to 144 (23 residues), see Phobius details amino acids 176 to 198 (23 residues), see Phobius details amino acids 210 to 232 (23 residues), see Phobius details amino acids 248 to 265 (18 residues), see Phobius details amino acids 275 to 298 (24 residues), see Phobius details amino acids 312 to 332 (21 residues), see Phobius details amino acids 352 to 374 (23 residues), see Phobius details amino acids 394 to 412 (19 residues), see Phobius details amino acids 424 to 443 (20 residues), see Phobius details amino acids 449 to 470 (22 residues), see Phobius details amino acids 483 to 504 (22 residues), see Phobius details amino acids 610 to 629 (20 residues), see Phobius details TIGR00353: cytochrome c-type biogenesis protein CcmF" amino acids 53 to 634 (582 residues), 967.4 bits, see alignment E=1.6e-295 PF01578: Cytochrom_C_asm" amino acids 89 to 296 (208 residues), 184.2 bits, see alignment E=2.6e-58 PF16327: CcmF_C" amino acids 316 to 630 (315 residues), 412.5 bits, see alignment E=1.3e-127

Best Hits

Swiss-Prot: 85% identical to CCMF_ECOLI: Cytochrome c-type biogenesis protein CcmF (ccmF) from Escherichia coli (strain K12)

KEGG orthology group: K02198, cytochrome c-type biogenesis protein CcmF (inferred from 86% identity to cko:CKO_00581)

MetaCyc: 85% identical to holocytochrome c synthase CcmF component (Escherichia coli K-12 substr. MG1655)
RXN-21423

Predicted SEED Role

"Cytochrome c heme lyase subunit CcmF" in subsystem Biogenesis of c-type cytochromes or Copper homeostasis

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (643 amino acids)

>GFF4877 Cytochrome c heme lyase subunit CcmF (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MMPEYGHALLCLALGVALLLSVYPLWGVARGDARMMASAGVFAWLLFICVAGAFFVLVHA
FVVNDFTVAYVAGNSNTQLPVWYRVAATWGAHEGSLLLWVLLMSGWTLAVAVFSRQVPAD
IVARVLAVMGMVCAGFLAFILFTSGPFARTLPAFPVEGRDLNPLLQDPGLIFHPPLLYMG
YVGFSVAFAFAIAALLSGRLDSAFTRFARPWTLAAWVFLTLGIVLGSAWAYYELGWGGWW
FWDPVENASFMPWLAGTALLHSLAVTEQRAGFKAWTLLLSICAFSLCLLGTFLVRSGVLV
SVHAFASDPARGMFILAFMVLVTGGSLLLFAVRGHRVRSRVNNALWSRESLLLGNNVLLM
AAMLVVLLGTLLPLVHKQLGLGSISVGEPFFNTMFTWLMVPFALLLGVGPLVRWGRDRPR
NIRTLLLTALVSTLVLSVLLPWLLEDKIIAMTAVGMAMACWIAVLAVAEAVQRVSRGTKT
SLSYWGMVAAHLGLAVTITGIAFSQNYSVERDVRMRAGDSVTIHDYRFTFREVRDITGPN
YRGGVALIGVTRHGEPEAVLHAEKRLYNTSRMVMTEAAIDGGLTRDLYAALGEELDNGAW
AVRLYYKPFVRWIWAGGLLMALGGLLCLADPRYRRRKPLPEAG