Protein Info for PS417_24960 in Pseudomonas simiae WCS417

Annotation: transposase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 525 PF13007: LZ_Tnp_IS66" amino acids 56 to 127 (72 residues), 42.3 bits, see alignment E=2.1e-14 PF13005: zf-IS66" amino acids 136 to 178 (43 residues), 50.4 bits, see alignment 4.7e-17 PF03050: DDE_Tnp_IS66" amino acids 192 to 473 (282 residues), 341.4 bits, see alignment E=9.1e-106 PF13817: DDE_Tnp_IS66_C" amino acids 480 to 517 (38 residues), 62.1 bits, see alignment 9e-21

Best Hits

KEGG orthology group: None (inferred from 82% identity to pba:PSEBR_a3785)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UP52 at UniProt or InterPro

Protein Sequence (525 amino acids)

>PS417_24960 transposase (Pseudomonas simiae WCS417)
MISPPSLDQLNPEQLRALATQVMQRVETLDHQVDTLGKTVETMGRKIHRDRTVIEKLTHE
IAQLKRFKFAKRSEQHSPAQAGLLDDLIDTDIAAIEAELEALQAKPASIETKQKPKRTAL
PPQFPRTLIHHEPDNTQCACGCALKRIGEDVSEKLDYTPGVFTVERHIRGKWVCDDCETL
IQAPVPAQIIDKGIPTAGLLAQVMIAKYGDHLPLYRQEQIFGRAGLAIPRSTLAQWVGTC
GVQLQPLVDALRGVVLGHNVVHADETPVQVLMPGAKKTHRAYVWAYASSAFADIKAVVYD
FTPSRAGEHARRFLQDWKGKLVCDDFGGYKASFSLGVTEIGCMAHARRKFFELHATNKSQ
LAEQALRYIQVLYEIEREVRDLEPDLRRRIRQEKAAPAMDVLHTWMIAQRERMHDGVAIA
KAFDYSLKRWTALSRYLDDGAVPIDNNHAEQQIRPWALGRKNWLYAGSLRSGQRAAALMS
LIQSAKLNGHDPYAYLKDVFTRLPTQRASEIAELLPHNWTHLRNL