Protein Info for GFF4875 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Dihydrolipoamide dehydrogenase of 2-oxoglutarate dehydrogenase (EC 1.8.1.4)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 475 TIGR01350: dihydrolipoyl dehydrogenase" amino acids 5 to 473 (469 residues), 540.1 bits, see alignment E=2.1e-166 PF07992: Pyr_redox_2" amino acids 5 to 337 (333 residues), 240.5 bits, see alignment E=9.2e-75 PF00890: FAD_binding_2" amino acids 6 to 38 (33 residues), 24.4 bits, see alignment (E = 5.8e-09) PF12831: FAD_oxidored" amino acids 6 to 45 (40 residues), 29.9 bits, see alignment 1.3e-10 PF01134: GIDA" amino acids 6 to 155 (150 residues), 22.1 bits, see alignment E=2.6e-08 PF00070: Pyr_redox" amino acids 185 to 259 (75 residues), 59.3 bits, see alignment E=1.6e-19 PF02852: Pyr_redox_dim" amino acids 356 to 465 (110 residues), 132.2 bits, see alignment E=3.2e-42

Best Hits

Swiss-Prot: 63% identical to DLDH_CUPNH: Dihydrolipoyl dehydrogenase (odhL) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K00382, dihydrolipoamide dehydrogenase [EC: 1.8.1.4] (inferred from 89% identity to aav:Aave_3246)

MetaCyc: 48% identical to dihydrolipoyl dehydrogenase subunit (Syntrophotalea carbinolica DSM 2380)

Predicted SEED Role

"Dihydrolipoamide dehydrogenase of 2-oxoglutarate dehydrogenase (EC 1.8.1.4)" in subsystem TCA Cycle (EC 1.8.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.4

Use Curated BLAST to search for 1.8.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (475 amino acids)

>GFF4875 Dihydrolipoamide dehydrogenase of 2-oxoglutarate dehydrogenase (EC 1.8.1.4) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSQSFDVVVIGGGPGGYIAAIRAAQLGFKVACIDEWKNAAGGPAPGGTCTNVGCIPSKAL
LQSSEHFDHANHHFADHGISATNVKIDIAKMVGRKDTVVKQNNDGILYLFKKNKVTFFHG
RGSFVKAVEAGYEIQVTGAKEEVITGQQIILATGSNARALPGVPFDEETVLSNDGALRIG
AVPKKLVLIGSGVIGLEMGSVWRRLGSDVTILEGLPTFLGAVDEQIAKEAKKAFDKQGLK
IELGVKVGDIKTGKKGVSVAYTNAKGEAQSIDADKLIVSIGRVPNTIGLNAEAVGLQLDE
RGAIVVDDECRTSLKGVWAVGDVVRGPMLAHKAEEEGVAVAERIAGQHGHVNFNTIPWVI
YTSPEIAWVGRTEQQLKADGVKYKAGTFPFLANGRARALGDTTGMVKFLADATSDEILGV
HIVGPMASELIAEAVVAMEFKASAEDIARICHAHPSLSEATKEAALAVDKRTLNF