Protein Info for GFF4869 in Variovorax sp. SCN45

Annotation: Type IV secretory pathway, protease TraF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 76 to 94 (19 residues), see Phobius details PF10502: Peptidase_S26" amino acids 20 to 190 (171 residues), 103.9 bits, see alignment E=4.5e-34

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpi:Rpic_2624)

Predicted SEED Role

"Type IV secretory pathway, protease TraF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (195 amino acids)

>GFF4869 Type IV secretory pathway, protease TraF (Variovorax sp. SCN45)
MTTISVSTAVTHPRSRLRARIVLAGLSVCGLAALAWASFVHPLPRLTYNPSDSVAVGWYR
VDPLDHRTSSPPHPLSVGSIVLVPLPAEAAALAAQRGYLPTRIPLLKRVGAVAPQEVCIA
DGRVLIDGVPSAAVLSADRWGRPLPSWQQCHRLRPGELFLLSVTNPASFDSRYFGPVSAA
AVIGVARPVWLESRP